ExactAntigen

Mouse Monoclonal anti-SMAD3 (2C12) | Novus Biologicals antibody product information
CatalogCode:H00004088-M01
ProductName:SMAD3 Antibody
Product Description:Mouse Monoclonal anti-SMAD3 (2C12)
Clone:2C12
Clonality:Monoclonal
Immunogen:SMAD3 (NP_005893, 120 a.a. ~ 222 a.a) partial recombinant protein with GST tag.
Epitope:VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL* ...
Specificity:SMAD3 - SMAD, mothers against DPP homolog 3 (Drosophila)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-HSPC193 antibody, anti-HST17436 antibody, anti-JV152 antibody, anti-MAD (mothers against decapentaplegic Drosophila) homolog 3 antibody, anti-MAD3 antibody, anti-MADH3 antibody, anti-Mothers against DPP homolog 3 antibody, anti-SMA and MAD related protein 3 antibody, anti-SMAD3 antibody, anti-DKFZP586N0721 antibody, anti-DKFZp686J10186 antibody
ProteinTarget:SMAD3 - SMAD, mothers against DPP homolog 3 (Drosophila)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:4088
Gene_Symbol:SMAD3
Omim_ID:603109,
order or
more information
:
company product webpage
request information:
Also see:
all human SMAD3 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about