ExactAntigen

SMAD1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004086-M06
Product Type:Primary Antibody
Product Name:SMAD1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4086
Host:Mouse
Clone:1B8
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-SMAD1 - SMAD, mothers against DPP homolog 1 (Drosophila) (1B8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional mo
Alternate Names:anti-BSP1 antibody, anti-JV4-1 antibody, anti-JV41 antibody, anti-MADH1 antibody, anti-MADR1 antibody
Immunogen:SMAD1 (AAH01878, 1 a.a. ~ 466 a.a) full length recombinant protein with GST tag.
Epitope:MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEI ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:SMAD1
see all human SMAD1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about