| Catalog Code: | H00004086-M06 |
| Product Type: | Primary Antibody |
| Product Name: | SMAD1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 4086 |
| Host: | Mouse |
| Clone: | 1B8 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-SMAD1 - SMAD, mothers against DPP homolog 1 (Drosophila) (1B8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional mo |
| Alternate Names: | anti-BSP1 antibody, anti-JV4-1 antibody, anti-JV41 antibody, anti-MADH1 antibody, anti-MADR1 antibody |
| Immunogen: | SMAD1 (AAH01878, 1 a.a. ~ 466 a.a) full length recombinant protein with GST tag. |
| Epitope: | MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEI ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is |
| Gene Symbol: | SMAD1 |