| Catalog Code: | H00004085-M01 |
| Product Type: | Primary Antibody |
| Product Name: | MAD2L1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 4085 |
| Host: | Mouse |
| Clone: | 2E2-1D6 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-MAD2L1 (2E2-1D6) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has bee |
| Alternate Names: | anti-HSMAD2 antibody, anti-MAD2 antibody |
| Immunogen: | MAD2L1 (AAH00356, 1 a.a. ~ 206 a.a) full length recombinant protein with GST tag. |
| Epitope: | MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | MAD2L1 |
| Omim ID: | 601467 |