ExactAntigen

MAD2L1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004085-M01
Product Type:Primary Antibody
Product Name:MAD2L1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4085
Host:Mouse
Clone:2E2-1D6
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-MAD2L1 (2E2-1D6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has bee
Alternate Names:anti-HSMAD2 antibody, anti-MAD2 antibody
Immunogen:MAD2L1 (AAH00356, 1 a.a. ~ 206 a.a) full length recombinant protein with GST tag.
Epitope:MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:MAD2L1
Omim ID:601467
see all human MAD2L1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about