| CatalogCode: | | H00004082-M06 |
| ProductName: | | MARCKS Antibody |
| Product Description: | | Mouse Monoclonal anti-MARCKS (2C2) |
| Clone: | | 2C2 |
| Clonality: | | Monoclonal |
| Immunogen: | | MARCKS (NP_002347, 2 a.a. ~ 66 a.a) partial recombinant protein with GST tag. |
| Epitope: | | GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP* ... |
| Specificity: | | MARCKS - myristoylated alanine-rich protein kinase C substrate |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | | The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-80K-L antibody, anti-FLJ14368 antibody, anti-MACS antibody, anti-MRACKS antibody, anti-PKCSL antibody, anti-PRKCSL antibody |
| ProteinTarget: | | MARCKS - myristoylated alanine-rich protein kinase C substrate |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 4082 |
| Gene_Symbol: | | MARCKS |
| Omim_ID: | | 177061, |
| more information: | | company product webpage |