ExactAntigen

NBR1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004077-A01
Product Type:Primary Antibody
Product Name:NBR1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:4077
Host:Mouse
Product Description:Mouse Polyclonal anti-NBR1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of t
Alternate Names:anti-KIAA0049 antibody, anti-M17S2 antibody, anti-MIG19 antibody
Immunogen:NBR1 (NP_005890, 2 a.a. ~ 97 a.a) partial recombinant protein with GST tag.
Epitope:EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV* ...
Specificity:Mouse polyclonal antibody raised against a partial recombinant NBR1.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NBR1
Omim ID:166945,
see all human NBR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about