ExactAntigen

Mouse Polyclonal anti-leucyl/cystinyl aminopeptidase | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00004012-A01
ProductName: leucyl/cystinyl aminopeptidase Antibody
Product Description: Mouse Polyclonal anti-leucyl/cystinyl aminopeptidase
Clonality: Polyclonal
Immunogen: LNPEP (NP_005566, 926 a.a. ~ 1026 a.a) partial recombinant protein with GST tag.
Epitope: FIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL* ...
Specificity: leucyl/cystinyl aminopeptidase
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera<br>Other applications have not been tested.
Background: This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-responsive glucose transporter GLUT4, or form a type II integral membrane glycoprotein. The protein catalyzes the final step in the conversion of angiotensinogen to angiotensin IV (AT4) and is also a receptor for AT4. Alternative splicing results in multiple transcript variants encoding different isoforms.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CAP antibody, anti-IRAP antibody, anti-P-LAP antibody, anti-PLAP antibody
ProteinTarget: leucyl/cystinyl aminopeptidase
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 4012
Gene_Symbol: LNPEP
Omim_ID: 151300,
more information: company product webpage
Also see:
see all human oxytocinase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about