| CatalogCode: | H00003996-M01 |
| ProductName: | LLGL1 Antibody |
| Product Description: | Mouse Monoclonal anti-LLGL1 (5G2) |
| Clone: | 5G2 |
| Clonality: | Monoclonal |
| Immunogen: | LLGL1 (NP_004131, 911 a.a. ~ 1011 a.a) partial recombinant protein with GST tag. |
| Epitope: | GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP* ... |
| Specificity: | LLGL1 - lethal giant larvae homolog 1 (Drosophila) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DLG4 antibody, anti-HUGL antibody, anti-HUGL-1 antibody, anti-HUGL1 antibody, anti-LLGL antibody |
| ProteinTarget: | LLGL1 - lethal giant larvae homolog 1 (Drosophila) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3996 |
| Gene_Symbol: | LLGL1 |
| Omim_ID: | 600966, |
order or
more information: | company product webpage |
| request information: |
|