ExactAntigen

LGALS3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003958-M01
Product Type:Primary Antibody
Product Name:LGALS3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3958
Host:Mouse
Clone:3C2-2A3
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-LGALS3 (3C2-2A3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = LGALS3 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-CBP35 antibody, anti-GAL3 antibody, anti-GALBP antibody, anti-LGALS2 antibody, anti-MAC2 antibody, anti-galectin 3 antibody
Immunogen:LGALS3 (AAH01120, 1 a.a. ~ 251 a.a) full length recombinant protein with GST tag.
Epitope:MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI* ...
Specificity:LGALS3 - lectin, galactoside-binding, soluble, 3 (galectin 3)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:LGALS3
Omim ID:153619
see all human galectin 3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about