ExactAntigen

LAMC1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003915-M03
Product Type:Primary Antibody
Product Name:LAMC1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3915
Host:Mouse
Clone:M1
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-LAMC1 (M1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = LAMC1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Laminins, a family
Alternate Names:anti-LAMB2 antibody, anti-MGC87297 antibody
Immunogen:LAMC1 (AAH15586, 1 a.a. ~ 39 a.a) full length recombinant protein with GST tag.
Epitope:MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS*
Specificity:LAMC1 - laminin, gamma 1 (formerly LAMB2)
Purity:Ascites
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:LAMC1
Omim ID:150290
see all human LAMC1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about