ExactAntigen

Mouse Monoclonal anti-LAMB3 (2G10)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00003914-M01
ProductName:LAMB3 Antibody
Product Description:Mouse Monoclonal anti-LAMB3 (2G10)
Clone:2G10
Clonality:Monoclonal
Immunogen:LAMB3 (NP_000219, 1064 a.a. ~ 1172 a.a) partial recombinant protein with GST tag.
Epitope:AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC* ...
Specificity:LAMB3 - laminin, beta 3
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-LAMNB1 antibody
ProteinTarget:LAMB3 - laminin, beta 3
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:3914
Gene_Symbol:LAMB3
see all human LAMB3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about