ExactAntigen

LAMA5 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003911-M01
Product Type:Primary Antibody
Product Name:LAMA5 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3911
Host:Mouse
Clone:2F7
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-LAMA5 (2F7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = LAMA5 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Components of the e
Alternate Names:anti-KIAA1907 antibody
Immunogen:LAMA5 (AAH03355, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Epitope:MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP ...
Specificity:LAMA5 - laminin, alpha 5
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Product References:Proteomic analysis of platelet a-granules using mass spectrometry.Maynard DM, Gahl WA. et al. J Thromb Haemost. 2007 Sep;5(9):1945-55.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:LAMA5
Omim ID:601033,
see all human LAMA5 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about