| Catalog Code: | H00003911-M01 |
| Product Type: | Primary Antibody |
| Product Name: | LAMA5 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3911 |
| Host: | Mouse |
| Clone: | 2F7 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-LAMA5 (2F7) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = LAMA5 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Components of the e |
| Alternate Names: | anti-KIAA1907 antibody |
| Immunogen: | LAMA5 (AAH03355, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP ... |
| Specificity: | LAMA5 - laminin, alpha 5 |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Product References: | Proteomic analysis of platelet a-granules using mass spectrometry.Maynard DM, Gahl WA. et al. J Thromb Haemost. 2007 Sep;5(9):1945-55. |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | LAMA5 |
| Omim ID: | 601033, |