| CatalogCode: | H00003875-M01 |
| ProductName: | KRT18 Antibody |
| Product Description: | Mouse Monoclonal anti-KRT18 (2F8) |
| Clone: | 2F8 |
| Clonality: | Monoclonal |
| Immunogen: | KRT18 (AAH00180, 1 a.a. ~ 431 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQ ... |
| Specificity: | KRT18 - keratin 18 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunofluorescence and immunohistochemistry on paraffin-embedded sections. |
| Background: | KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. Two transcript variants encoding the same protein have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P, IF |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CYK18 antibody, anti-K18 antibody |
| ProteinTarget: | KRT18 - keratin 18 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3875 |
| Gene_Symbol: | KRT18 |
| Omim_ID: | 148,070,215,600 H00003875-B01 |
order or more information: | company product webpage |
| request information: | |