| CatalogCode: | | H00003868-A01 |
| ProductName: | | KRT16 Antibody |
| Product Description: | | Mouse Polyclonal anti-KRT16 |
| Clonality: | | Polyclonal |
| Immunogen: | | KRT16 (NP_005548, 301 a.a. ~ 399 a.a) partial recombinant protein with GST tag. |
| Epitope: | | RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQ* ... |
| Specificity: | | KRT16 - keratin 16 (focal non-epidermolytic palmoplantar keratoderma) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | | The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CK16 antibody, anti-K16 antibody, anti-K1CP antibody, anti-KRT16A antibody, anti-NEPPK antibody |
| ProteinTarget: | | KRT16 - keratin 16 (focal non-epidermolytic palmoplantar keratoderma) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 3868 |
| Gene_Symbol: | | KRT16 |
| Omim_ID: | | 144200 148067 167200 600962 |
| more information: | | company product webpage |