ExactAntigen

KRT7 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003855-B01
Product Type:Primary Antibody
Product Name:KRT7 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:3855
Host:Mouse
Product Description:Mouse Polyclonal anti-KRT7 - keratin 7, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.
Alternate Names:anti-CK7 antibody, anti-K2C7 antibody, anti-K7 antibody, anti-MGC129731 antibody, anti-MGC3625 antibody, anti-SCL antibody
Immunogen:KRT7 (-, 1 a.a. ~ 469 a.a) full-length human protein.
Epitope:MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSL ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human KRT7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about