| Catalog Code: | H00003795-A01 |
| Product Type: | Primary Antibody |
| Product Name: | KHK Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 3795 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-KHK |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose. Alternatively spliced transcript variants encoding d |
| Immunogen: | KHK (AAH06233, 1 a.a. ~ 299 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLG ... |
| Specificity: | KHK - ketohexokinase (fructokinase) |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Product References: | Levi J, Gambhir SS et al.. Fluorescent Fructose Derivatives for Imaging Breast Cancer Cells. Bioconjug Chem. 2007 May-Jun;18(3):628-34. Epub 2007 Apr 20. |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | KHK |
| Omim ID: | 229800 |