ExactAntigen

KDR Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003791-M05
Product Type:Primary Antibody
Product Name:KDR Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3791
Host:Mouse
Clone:4F1
Product Description:Mouse Monoclonal anti-KDR (4F1)
Species Summary:Hu
Alternate Names:anti-FLK1 antibody, anti-VEGFR antibody, anti-VEGFR2 antibody
Immunogen:KDR (NP_002244, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Epitope:LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS ...
Purity:protein A purified
Buffer:1x PBS, pH 7.2
Packaging:0.1 ml protein A purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:KDR
Omim ID:191306, 602089,
see all human KDR antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about