ExactAntigen

Mouse Monoclonal anti-KDR (4A2) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00003791-M02
ProductName: KDR Antibody
Product Description: Mouse Monoclonal anti-KDR (4A2)
Clone: 4A2
Clonality: Monoclonal
Immunogen: KDR (NP_002244, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Epitope: LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS ...
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: protein A purified
Host_Name: Mouse
Buffer: 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-FLK1 antibody, anti-VEGFR antibody, anti-VEGFR2 antibody
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 3791
Gene_Symbol: KDR
Omim_ID: 191306, 602089,
more information: company product webpage
Also see:
see all human KDR antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about