| CatalogCode: | H00003772-M01 |
| ProductName: | KCNJ15 Antibody |
| Product Description: | Mouse Monoclonal anti-KCNJ15 (1B2) |
| Clone: | 1B2 |
| Clonality: | Monoclonal |
| Immunogen: | KCNJ15 (NP_002234, 290 a.a. ~ 356 a.a) partial recombinant protein with GST tag. |
| Epitope: | TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-KIR1.3 antibody, anti-KIR4.2 antibody, anti-MGC13584 antibody |
| ProteinTarget: | potassium inwardly-rectifying channel, subfamily J, member 15 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3772 |
| Gene_Symbol: | KCNJ15 |
| Omim_ID: | 602106, |
order or
more information: | company product webpage |
| request information: |
|