ExactAntigen

Mouse Polyclonal anti-potassium voltage-gated channel, subfamily H (eag-related), member 1
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00003756-A01
ProductName:potassium voltage-gated channel, subfamily H (eag-related), member 1 Antibody
Product Description:Mouse Polyclonal anti-potassium voltage-gated channel, subfamily H (eag-related), member 1
Clonality:Polyclonal
Immunogen:KCNH1 (NP_758872, 890 a.a. ~ 989 a.a) partial recombinant protein with GST tag.
Epitope:RLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPESERDIFGA* ...
Specificity:potassium voltage-gated channel, subfamily H (eag-related), member 1
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera
Background:Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-EAG antibody, anti-EAG1 antibody, anti-Kv10.1 antibody, anti-h-eag antibody
ProteinTarget:potassium voltage-gated channel, subfamily H (eag-related), member 1
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:3756
Gene_Symbol:KCNH1
Omim_ID:603305,
see all human KCNH1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about