ExactAntigen

KCNE1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003753-M13
Product Type:Primary Antibody
Product Name:KCNE1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3753
Host:Mouse
Clone:2A6
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-KCNE1 (2A6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.KCNE1 together with KCNQ1 encode the two subunits of the K+ c
Alternate Names:anti-ISK antibody, anti-JLNS antibody, anti-LQT5 antibody, anti-MGC33114 antibody, anti-MinK antibody
Immunogen:KCNE1 (AAH36452, 1 a.a. ~ 106 a.a) full length recombinant protein with GST tag.
Epitope:MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:KCNE1
Omim ID:176261, 220400,
see all human KCNE1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about