| CatalogCode: | H00003739-A01 |
| ProductName: | potassium voltage-gated channel, shaker-related subfamily, member 4 Antibody |
| Product Description: | Mouse Polyclonal anti-potassium voltage-gated channel, shaker-related subfamily, member 4 |
| Clonality: | Polyclonal |
| Immunogen: | KCNA4 (NP_002224, 562 a.a. ~ 653 a.a) partial recombinant protein with GST tag. |
| Epitope: | NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETD* ... |
| Specificity: | potassium voltage-gated channel, shaker-related subfamily, member 4 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influnce the duration of cardiac action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HBK4 antibody, anti-HK1 antibody, anti-HPCN2 antibody, anti-HUKII antibody, anti-KCNA4L antibody, anti-KCNA8 antibody, anti-KV1.4 antibody, anti-PCN2 antibody |
| ProteinTarget: | potassium voltage-gated channel, shaker-related subfamily, member 4 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3739 |
| Gene_Symbol: | KCNA4 |
| Omim_ID: | 176266, |
|