ExactAntigen

JUP Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003728-M01
Product Type:Primary Antibody
Product Name:JUP Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3728
Host:Mouse
Clone:2G9
Isotype:IgG Mix kappa
Product Description:Mouse Monoclonal anti-JUP (2G9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = JUP PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a m
Alternate Names:anti-CTNNG antibody, anti-DP3 antibody, anti-DPIII antibody, anti-PDGB antibody, anti-PKGB antibody
Immunogen:JUP (AAH11865, 1 a.a. ~ 746 a.a) full length recombinant protein with GST tag.
Epitope:MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLL ...
Specificity:JUP - junction plakoglobin
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:JUP
Omim ID:173325 601214
see all human JUP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about