| Catalog Code: | H00003702-B01 |
| Product Type: | Primary Antibody |
| Product Name: | ITK Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 3702 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-ITK - IL2-inducible T-cell kinase, MaxPab Antibody |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein contains both SH2 and SH3 domains which are often found in intracellular kinases. It is thought to play a role in T-cell proliferation and differentiation. |
| Alternate Names: | anti-EMT antibody, anti-LYK antibody, anti-MGC126257 antibody, anti-MGC126258 antibody, anti-PSCTK2 antibody |
| Immunogen: | ITK (-, 1 a.a. ~ 620 a.a) full-length human protein. |
| Epitope: | MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKYHPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLD ... |
| Preservative: | No Preservative |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Application Summary: | Western Blot 1:500, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |