ExactAntigen

ITGAE Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003682-A01
Product Type:Primary Antibody
Product Name:ITGAE Antibody
List Price:205
Clonality:Polyclonal
Gene ID:3682
Host:Mouse
Product Description:Mouse Polyclonal anti-ITGAE
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked h
Alternate Names:anti-CD103 antibody, anti-HUMINAE antibody
Immunogen:ITGAE (NP_002199, 57 a.a. ~ 172 a.a) partial recombinant protein with GST tag.
Epitope:SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV* ...
Specificity:Mouse polyclonal antibody raised against a partial recombinant ITGAE.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ITGAE
Omim ID:604682,
see all human ITGAE antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about