ExactAntigen

ITGA7 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003679-M01
Product Type:Primary Antibody
Product Name:ITGA7 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3679
Host:Mouse
Clone:8G2
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-ITGA7 (8G2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:ITGA7 encodes integrin alpha chain 7. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 7 undergoes post-translational cleavage within the extracellular domain to yield disulfide-linked light a
Immunogen:ITGA7 (NP_002197, 478 a.a. ~ 578 a.a) partial recombinant protein with GST tag.
Epitope:SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ* ...
Specificity:ITGA7 - integrin, alpha 7
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ITGA7
Omim ID:600536,
see all human ITGA7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about