| Catalog Code: | H00003679-M01 |
| Product Type: | Primary Antibody |
| Product Name: | ITGA7 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3679 |
| Host: | Mouse |
| Clone: | 8G2 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-ITGA7 (8G2) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | ITGA7 encodes integrin alpha chain 7. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 7 undergoes post-translational cleavage within the extracellular domain to yield disulfide-linked light a |
| Immunogen: | ITGA7 (NP_002197, 478 a.a. ~ 578 a.a) partial recombinant protein with GST tag. |
| Epitope: | SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ* ... |
| Specificity: | ITGA7 - integrin, alpha 7 |
| Purity: | IgG purified |
| Packaging: | 0.1 ml IgG purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | ITGA7 |
| Omim ID: | 600536, |