| CatalogCode: | H00003656-M02 |
| ProductName: | IRAK2 Antibody |
| Product Description: | Mouse Monoclonal anti-IRAK2 (3G6) |
| Clone: | 3G6 |
| Clonality: | Monoclonal |
| Immunogen: | IRAK2 (NP_001561, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Epitope: | KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF ... |
| Specificity: | IRAK2 - interleukin-1 receptor-associated kinase 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-IRAK-2 antibody |
| ProteinTarget: | IRAK2 - interleukin-1 receptor-associated kinase 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3656 |
| Gene_Symbol: | IRAK2 |
| Omim_ID: | 603304, |
order or
more information: | company product webpage |
| request information: |
|