ExactAntigen

INPPL1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003636-M01
Product Type:Primary Antibody
Product Name:INPPL1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3636
Host:Mouse
Clone:3E6
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-INPPL1 (3E6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = INPPL1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.INPPL1 encodes ino
Alternate Names:anti-INPPL1 antibody, anti-INPPL-1 antibody, anti-Inositol Polyphosphate Phosphatase-like 1 antibody, anti-SHIP2 antibody, anti-SH2 domain containing Inositol 5-Phosphatase 2 antibody
Immunogen:INPPL1 (NP_001558, 1159 a.a. ~ 1259 a.a) partial recombinant protein with GST tag.
Epitope:PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK* ...
Specificity:INPPL1 - inositol polyphosphate phosphatase-like 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:INPPL1
Omim ID:600829
see all human SHIP2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about