ExactAntigen

IL16 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003603-B01
Product Type:Primary Antibody
Product Name:IL16 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:3603
Host:Mouse
Product Description:Mouse Polyclonal anti-IL16 - interleukin 16 (lymphocyte chemoattractant factor), MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. The signaling process of this cytokine is mediated by CD4. The product of this gene unde
Alternate Names:anti-FLJ44234 antibody, anti-HsT19289 antibody, anti-IL-16 antibody, anti-LCF antibody, anti-prIL-16 antibody
Immunogen:IL16 (AAH40272, 1 a.a. ~ 454 a.a) full-length human protein.
Epitope:MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFAGGAA ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human IL16 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about