| CatalogCode: | H00003576-M10 |
| ProductName: | IL8 Antibody |
| Product Description: | Mouse Monoclonal anti-IL8 (4F10) |
| Clone: | 4F10 |
| Clonality: | Monoclonal |
| Immunogen: | IL8 (AAH13615, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Epitope: | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-3-10C antibody, anti-AMCF-I antibody, anti-CXCL8 antibody, anti-GCP-1 antibody, anti-GCP1 antibody, anti-IL-8 antibody, anti-K60 antibody, anti-LECT antibody, anti-LUCT antibody, anti-LYNAP antibody, anti-MDNCF antibody, anti-MONAP antibody, anti-NAF antibody, anti-NAP-1 antibody, anti-NAP1 antibody, anti-SCYB8 antibody, anti-TSG-1 antibody, anti-b-ENAP antibody |
| ProteinTarget: | IL8 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3576 |
| Gene_Symbol: | IL8 |
| Omim_ID: | 146930, |
order or more information: | company product webpage |
| request information: | |
|