| request information: |
|
| Catalog Code: | H00003576-M07 |
| Product Name: | IL8 Antibody |
| Product Description: | Mouse Monoclonal anti-IL8 (4G10) |
| Clone: | 4G10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 3576 |
| Gene Symbol: | IL8 |
| Omim ID: | 146930, |
| Immunogen: | IL8 (AAH13615, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Epitope: | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-3-10C antibody, anti-AMCF-I antibody, anti-CXCL8 antibody, anti-GCP-1 antibody, anti-GCP1 antibody, anti-IL-8 antibody, anti-K60 antibody, anti-LECT antibody, anti-LUCT antibody, anti-LYNAP antibody, anti-MDNCF antibody, anti-MONAP antibody, anti-NAF antibody, anti-NAP-1 antibody, anti-NAP1 antibody, anti-SCYB8 antibody, anti-TSG-1 antibody, anti-b-ENAP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |
|