ExactAntigen

Mouse Monoclonal anti-inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta (1A3)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00003551-M04
ProductName:inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta Antibody
Product Description:Mouse Monoclonal anti-inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta (1A3)
Clone:1A3
Clonality:Monoclonal
Immunogen:IKBKB (AAH06231, 3 a.a. ~ 121 a.a) partial recombinant protein with GST tag.
Epitope:WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG* ...
Specificity:inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:1X PBS pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-IKK-beta antibody, anti-IKK2 antibody, anti-IKKB antibody, anti-NFKBIKB antibody
ProteinTarget:inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:3551
Gene_Symbol:IKBKB
Omim_ID:603258,
see all human IKBKB antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about