| CatalogCode: | H00003547-A01 |
| ProductName: | IGSF1 Antibody |
| Product Description: | Mouse Polyclonal anti-IGSF1 |
| Clonality: | Polyclonal |
| Immunogen: | IGSF1 (NP_001546, 220 a.a. ~ 311 a.a) partial recombinant protein with GST tag. |
| Epitope: | VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD* ... |
| Specificity: | IGSF1 - immunoglobulin superfamily, member 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-IGCD1 antibody, anti-IGDC1 antibody, anti-INHBP antibody, anti-KIAA0364 antibody, anti-MGC75490 antibody, anti-PGSF2 antibody |
| ProteinTarget: | IGSF1 - immunoglobulin superfamily, member 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3547 |
| Gene_Symbol: | IGSF1 |
| Omim_ID: | 300137 H00285313-A01 |
order or
more information: | company product webpage |
| request information: |
|