ExactAntigen

IFNAR1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003454-M01
Product Type:Primary Antibody
Product Name:IFNAR1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3454
Host:Mouse
Clone:1H2
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-IFNAR1 (1H2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several prote
Alternate Names:anti-AVP antibody, anti-IFN-alpha-REC antibody, anti-IFNAR antibody, anti-IFNBR antibody, anti-IFRC antibody
Immunogen:IFNAR1 (AAH21825, 28 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Epitope:KNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQ* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:IFNAR1
Omim ID:107450
see all human IFNAR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about