| Catalog Code: | H00003428-M06 |
| Product Type: | Primary Antibody |
| Product Name: | IFI16 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3428 |
| Host: | Mouse |
| Clone: | 5C10 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-IFI16 (5C10) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein |
| Alternate Names: | anti-IFNGIP1 antibody, anti-PYHIN2 antibody |
| Immunogen: | IFI16 (AAH17059, 630 a.a. ~ 730 a.a) partial recombinant protein with GST tag. |
| Epitope: | FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | IFI16 |
| Omim ID: | 147586, |