ExactAntigen

IFI16 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003428-M06
Product Type:Primary Antibody
Product Name:IFI16 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3428
Host:Mouse
Clone:5C10
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-IFI16 (5C10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein
Alternate Names:anti-IFNGIP1 antibody, anti-PYHIN2 antibody
Immunogen:IFI16 (AAH17059, 630 a.a. ~ 730 a.a) partial recombinant protein with GST tag.
Epitope:FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:IFI16
Omim ID:147586,
see all human IFI16 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about