ExactAntigen

Mouse Monoclonal anti-IFI16 (2E3)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00003428-M03
ProductName:IFI16 Antibody
Product Description:Mouse Monoclonal anti-IFI16 (2E3)
Clone:2E3
Clonality:Monoclonal
Immunogen:IFI16 (AAH17059, 630 a.a. ~ 730 a.a) partial recombinant protein with GST tag.
Epitope:FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF* ...
Specificity:IFI16 - interferon, gamma-inducible protein 16
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-IFNGIP1 antibody, anti-PYHIN2 antibody
ProteinTarget:IFI16 - interferon, gamma-inducible protein 16
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:3428
Gene_Symbol:IFI16
Omim_ID:147586,
see all human IFI16 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about