ExactAntigen

IDH3B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003420-M01
Product Type:Primary Antibody
Product Name:IDH3B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3420
Host:Mouse
Clone:3A10
Isotype:IgG3 Kappa
Product Description:Mouse Monoclonal anti-IDH3B (3A10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = IDH3B PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Isocitrate dehydrog
Alternate Names:anti-FLJ11043 antibody, anti-H-IDHB antibody, anti-MGC903 antibody
Immunogen:IDH3B (NP_008830, 296 a.a. ~ 385 a.a) partial recombinant protein with GST tag.
Epitope:YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG* ...
Specificity:IDH3B - isocitrate dehydrogenase 3 (NAD+) beta
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:IDH3B
Omim ID:604526,
see all human IDH3B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about