| Catalog Code: | H00003398-M04 |
| Product Type: | Primary Antibody |
| Product Name: | ID2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3398 |
| Host: | Mouse |
| Clone: | 2C11 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-ID2 (2C11) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of ba |
| Alternate Names: | anti-GIG8 antibody, anti-ID2A antibody, anti-ID2H antibody, anti-MGC26389 antibody |
| Immunogen: | ID2 (AAH30639, 1 a.a. ~ 135 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | ID2 |
| Omim ID: | 600386, |