| CatalogCode: | H00003398-M01 |
| ProductName: | inhibitor of DNA binding 2, dominant negative helix-loop-helix protein Antibody |
| Product Description: | Mouse Monoclonal anti-inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (3C3) |
| Clone: | 3C3 |
| Clonality: | Monoclonal |
| Immunogen: | ID2 (AAH30639, 1 a.a. ~ 135 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG* ... |
| Specificity: | inhibitor of DNA binding 2, dominant negative helix-loop-helix protein |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GIG8 antibody, anti-ID2A antibody, anti-ID2H antibody, anti-MGC26389 antibody |
| ProteinTarget: | inhibitor of DNA binding 2, dominant negative helix-loop-helix protein |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3398 |
| Gene_Symbol: | ID2 |
| Omim_ID: | 600386, |
order or
more information: | company product webpage |
| request information: |
|