ExactAntigen

ID2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003398-B01
Product Type:Primary Antibody
Product Name:ID2 Antibody
List Price:275
Clonality:Polyclonal
Gene ID:3398
Host:Mouse
Product Description:Mouse Polyclonal anti-ID2
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of ba
Alternate Names:anti-GIG8 antibody, anti-ID2A antibody, anti-ID2H antibody, anti-MGC26389 antibody
Immunogen:ID2 (AAH30639, 1 a.a. ~ 135 a.a) full-length human protein.
Epitope:MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG* ...
Specificity:Mouse polyclonal antibody raised against a full-length human ID2 protein.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to Western blot on transfected lysate. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). MaxPab is a registered trademark of Abno
Gene Symbol:ID2
Omim ID:600386,
see all human ID2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about