| Catalog Code: | H00003397-M14 |
| Product Type: | Primary Antibody |
| Product Name: | ID1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3397 |
| Host: | Mouse |
| Clone: | 3F3 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-ID1 (3F3) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and tr |
| Alternate Names: | anti-ID antibody |
| Immunogen: | ID1 (NP_002156, 47 a.a. ~ 155 a.a) full length recombinant protein with GST tag. |
| Epitope: | GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is |
| Gene Symbol: | ID1 |
| Omim ID: | 600349, |