ExactAntigen

ID1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003397-M14
Product Type:Primary Antibody
Product Name:ID1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3397
Host:Mouse
Clone:3F3
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-ID1 (3F3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and tr
Alternate Names:anti-ID antibody
Immunogen:ID1 (NP_002156, 47 a.a. ~ 155 a.a) full length recombinant protein with GST tag.
Epitope:GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:ID1
Omim ID:600349,
see all human ID1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about