| CatalogCode: | | H00003373-A01 |
| ProductName: | | hyaluronoglucosaminidase 1 Antibody |
| Product Description: | | Mouse Polyclonal anti-hyaluronoglucosaminidase 1 |
| Clonality: | | Polyclonal |
| Immunogen: | | HYAL1 (NP_009296, 60 a.a. ~ 160 a.a) partial recombinant protein with GST tag. |
| Epitope: | | ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH* ... |
| Specificity: | | hyaluronoglucosaminidase 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | | This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-HYAL-1 antibody, anti-LUCA1 antibody, anti-MGC45987 antibody, anti-NAT6 antibody |
| ProteinTarget: | | hyaluronoglucosaminidase 1 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 3373 |
| Gene_Symbol: | | HYAL1 |
| Omim_ID: | | 601492, 607071, |
| more information: | | company product webpage |