ExactAntigen

NDST1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003340-M03
Product Type:Primary Antibody
Product Name:NDST1 Antibody
List Price:295
Clonality:Monoclonal
Gene ID:3340
Host:Mouse
Clone:2F11
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-NDST1 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 (2F11)
Cross Reactivity:Human.
Species Summary:Hu(+)
Alternate Names:anti-HSST antibody, anti-NST1 antibody
Immunogen:NDST1 (NP_001534, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Packaging:0.1 mg IgG purified Mouse ascites.
PackageSize:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, , Western Blot 1:500
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human NDST1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about