| Catalog Code: | H00003340-M03 |
| Product Type: | Primary Antibody |
| Product Name: | NDST1 Antibody |
| List Price: | 295 |
| Clonality: | Monoclonal |
| Gene ID: | 3340 |
| Host: | Mouse |
| Clone: | 2F11 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-NDST1 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 (2F11) |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Alternate Names: | anti-HSST antibody, anti-NST1 antibody |
| Immunogen: | NDST1 (NP_001534, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Preservative: | No Preservative |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| PackageSize: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, , Western Blot 1:500 |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |