ExactAntigen

HSPB1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003315-A01
Product Type:Primary Antibody
Product Name:HSPB1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:3315
Host:Mouse
Product Description:Mouse Polyclonal anti-HSPB1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 3315 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-CMT2F antibody, anti-DKFZp586P1322 antibody, anti-HS.76067 antibody, anti-HSP27 antibody, anti-HSP28 antibody, anti-Hsp25 antibody
Immunogen:HSPB1 (NP_001531, 96 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Epitope:RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK* ...
Specificity:HSPB1 - heat shock 27kDa protein 1
Purity:Whole antisera
Packaging:50 ul Whole antisera Mouse antisera.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:HSPB1
Omim ID:602195 606595 608634
see all human HSPB1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about