ExactAntigen

HOXD8 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003234-M03
Product Type:Primary Antibody
Product Name:HOXD8 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3234
Host:Mouse
Clone:5E11
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-HOXD8 - homeobox D8 (5E11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
Alternate Names:anti-HOX4 antibody, anti-HOX4E antibody, anti-HOX5.4 antibody
Immunogen:HOXD8 (NP_062458, 126 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Epitope:GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:HOXD8
see all human HOXD8 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about