ExactAntigen

Mouse Monoclonal anti-HOXC13 (10D4) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00003229-M01
ProductName: HOXC13 Antibody
Product Description: Mouse Monoclonal anti-HOXC13 (10D4)
Clone: 10D4
Clonality: Monoclonal
Immunogen: HOXC13 (NP_059106, 132 a.a. ~ 232 a.a) partial recombinant protein with GST tag.
Epitope: CRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSK* ...
Specificity: HOXC13 - homeo box C13
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the development of hair, nail, and filiform papilla.
Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-HOX3 antibody, anti-HOX3G antibody
ProteinTarget: HOXC13 - homeo box C13
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 3229
Gene_Symbol: HOXC13
Omim_ID: 142976 H00003221-A01
more information: company product webpage
Also see:
see all human HOXC13 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about