| CatalogCode: | | H00003176-A01 |
| ProductName: | | HNMT Antibody |
| Product Description: | | Mouse Polyclonal anti-HNMT |
| Clonality: | | Polyclonal |
| Immunogen: | | HNMT (AAH05907, 1 a.a. ~ 52 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC* ... |
| Specificity: | | HNMT - histamine N-methyltransferase |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-HMT antibody, anti-HNMT-S1 antibody, anti-HNMT-S2 antibody |
| ProteinTarget: | | HNMT - histamine N-methyltransferase |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 3176 |
| Gene_Symbol: | | HNMT |
| Omim_ID: | | 605238 H00003176-M03 |
| more information: | | company product webpage |