| CatalogCode: | | H00003172-M05 |
| ProductName: | | HNF4A Antibody |
| Product Description: | | Mouse Monoclonal anti-HNF4A (1F12) |
| Clone: | | 1F12 |
| Clonality: | | Monoclonal |
| Immunogen: | | HNF4A (NP_000448, 324 a.a. ~ 424 a.a) partial recombinant protein with GST tag. |
| Epitope: | | NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP* ... |
| Specificity: | | HNF4A - hepatocyte nuclear factor 4, alpha |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-FLJ39654 antibody, anti-HNF4 antibody, anti-HNF4a7 antibody, anti-HNF4a8 antibody, anti-HNF4a9 antibody, anti-MODY antibody, anti-MODY1 antibody, anti-NR2A1 antibody, anti-NR2A21 antibody, anti-TCF antibody, anti-TCF14 antibody |
| ProteinTarget: | | HNF4A - hepatocyte nuclear factor 4, alpha |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 3172 |
| Gene_Symbol: | | HNF4A |
| Omim_ID: | | 125850, 125853, 600281, |
| more information: | | company product webpage |