| CatalogCode: | H00003148-M01 |
| ProductName: | HMGB2 Antibody |
| Product Description: | Mouse Monoclonal anti-HMGB2 (2H5-G9) |
| Clone: | 2H5-G9 |
| Clonality: | Monoclonal |
| Immunogen: | HMGB2 (AAH00903, 1 a.a. ~ 196 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE* ... |
| Specificity: | HMGB2 - high-mobility group box 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HMG2 antibody |
| ProteinTarget: | HMGB2 - high-mobility group box 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 3148 |
| Gene_Symbol: | HMGB2 |
| Omim_ID: | 163906 H00003148-M02 |
order or
more information: | company product webpage |
| request information: |
|