| request information: |
|
| Catalog Code: | H00003098-M01 |
| Product Name: | HK1 Antibody |
| Product Description: | Mouse Monoclonal anti-HK1 (5G9) |
| Clone: | 5G9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 3098 |
| Gene Symbol: | HK1 |
| Omim ID: | 142600, |
| Immunogen: | HK1 (NP_277031, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. |
| Epitope: | NQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDA* |
| Specificity: | HK1 - hexokinase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation and ELISA. |
| Background: | Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-HK1-ta antibody, anti-HK1-tb antibody, anti-HKI antibody, anti-HXK1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |