ExactAntigen

HBZ Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00003050-M03
Product Type:Primary Antibody
Product Name:HBZ Antibody
List Price:275
Clonality:Monoclonal
Gene ID:3050
Host:Mouse
Clone:1G10
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-HBZ (1G10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluste
Immunogen:HBZ (NP_005323, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag.
Epitope:MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:HBZ
Omim ID:142310,
see all human HBZ antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about