| Catalog Code: | H00003050-M03 |
| Product Type: | Primary Antibody |
| Product Name: | HBZ Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3050 |
| Host: | Mouse |
| Clone: | 1G10 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-HBZ (1G10) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluste |
| Immunogen: | HBZ (NP_005323, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is |
| Gene Symbol: | HBZ |
| Omim ID: | 142310, |